DPCstruct | MC18865
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 70 ± 6 aa |
| Standard deviation of domain lengths | 6.04 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 91.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 58.62 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A098TMA6 | 1-75 | MLEAYRQQVAERAALGIPPLPLSAQQTTELCELLKTPPVGEADFLLSLVRDRVPPGVDQAAYVKAGFLTAIAHST |
| A0A496KGZ4 | 1-62 | MLEAYRKAAAERAALGIPPLPLNAQQTADLVELLKNPPAGEGEFLVELLAHRVPPGVDDAAK |
| L8M2X7 | 1-62 | None |
| A0A812QR35 | 36-108 | None |
| A0A3S4XVA6 | 1-62 | None |
| A0A5W4L7L6 | 1-75 | None |
| A0A375HDG3 | 39-112 | None |
| A0A484ZJB7 | 1-75 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.