DPCstruct | MC18861
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 585 ± 106 aa |
| Standard deviation of domain lengths | 105.98 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 63.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.34 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 17.53 |
| Pfam Score | 80.69 |
| Assigned Pfam label(s) | PF14613- PF19343 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A139AXS6 | 263-730 | VERDLPATFTQEERGSRPERKTSSYVDDAADVIAERLSVEKRQRLVDRFRRICEDLSGNEGYRSSIKYLLSMLERLASATVGGGQDV… |
| A0A7S1A4I1 | 479-911 | DRKVKQKALELCSATQTYLSGRFGIEDTAGMDSWLQTLRGHVLEHLGLQRAMLVDSLSGLRLDHLDLRHFISSSWDPVSVESQLQVA… |
| E4ZYR4 | 37-593 | None |
| A0A0F4Z307 | 30-774 | None |
| A0A146HPE3 | 90-762 | None |
| A0A094IV52 | 29-793 | None |
| A0A4Z0AAK2 | 7-697 | None |
| F4RIZ2 | 47-579 | None |
| A0A381LF51 | 30-624 | None |
| A0A060SNU9 | 24-528 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.