DPCstruct | MC1886
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 191 ± 29 aa |
| Standard deviation of domain lengths | 29.39 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 81.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 27.19 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10355 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| L8WYX9 | 79-245 | MALESRTIRRLLSNASIIGNPRARSHPLTEPPSYSGSFNPFPAIVIGVTGAAMSAHHQNYVFQVKIHELWGNLLVAFAVMRCFTYFF… |
| A0A5B0MEJ3 | 1-212 | MWASGGGLGIYLSRGGRRSVMSGVVIIVTGWAFQSHQQSLEISTRIHGAFGATLMAAGLVKIISVVRRAPAVDDHLPPPQPGLDPLD… |
| A0A6A6Q607 | 183-348 | None |
| F4RZS1 | 216-374 | None |
| A0A6G1MMC8 | 67-260 | None |
| A0A0D2J5M8 | 24-203 | None |
| Q6C5B1 | 534-691 | None |
| A0A139ASI6 | 5-219 | None |
| A0A5N6YCI0 | 77-252 | None |
| A0A6A6AFX9 | 410-597 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.