DPCstruct | MC18859
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 247 ± 21 aa |
| Standard deviation of domain lengths | 21.13 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 77.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 29.64 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05154 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S2BL76 | 5-256 | VGWAGALARRPAAAIALAAITASLQGCTVPHVDGYIDVSDANVASHLVPYWRSERDYFESLSYTDPTTQLPSFNSCMDTKLNVLDVC… |
| A0A7S0ZZX7 | 6-260 | WEGYFDMSDLSITTHPYGNWAANPSYFERIGYRKDNNNNTSNTTLTSALFFNSCGDDELTAQTVCSGNGKCVAWNPDDISAVFFCQC… |
| A0A812T3P6 | 583-828 | None |
| A0A812SDF2 | 23-248 | None |
| A0A7S1FHK9 | 92-364 | None |
| A0A7S1FHI9 | 5-283 | None |
| A0A1I8G3Q7 | 20-254 | None |
| A0A058ZC93 | 1-274 | None |
| A0A812LVF6 | 23-248 | None |
| A0A7S2QEK8 | 239-482 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.