DPCstruct | MC18855
Metacluster Properties and Pfam Annotations
| Number of structural domains | 649 |
|---|---|
| Mean domain length (aa) | 163 ± 28 aa |
| Standard deviation of domain lengths | 28.45 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 83.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 15.78 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04773 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2S6UEH5 | 9-165 | VAMQAAIPRPLKVGDKIQRGDVLSTGRGARLEVEMLDDAIMTLGEKTNFIVIDYIIGNEPIAALRLLQGAFSAVSGKMMQTAAAKFT… |
| A0A7C7KWM4 | 27-198 | RVMQRVATVRVVEGEAFVHRAGRESKRIPLKQGMLVKTFDVIRTGKLGRVVLHWVDDFELEIKPNTVLRIMRSSFNKSTKATISLFF… |
| M3E060 | 1-133 | None |
| A0A3D5A222 | 27-196 | None |
| A0A7X9DJS3 | 63-219 | None |
| A0A7D5RXW7 | 5-152 | None |
| A0A7D5S3V5 | 4-116 | None |
| A0A2E6TDW2 | 40-257 | None |
| A0A841M2M6 | 21-199 | None |
| A0A2S2CKC8 | 152-281 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.