DPCstruct | MC18844
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 129 ± 15 aa |
| Standard deviation of domain lengths | 15.15 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 88.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.54 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 29.21 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1E9VQE1 | 9-135 | CDLSNLKTINTRHYADKVTQKSVAKEKNTVVNRKAVDISADVQAIRDGKVNIINNQFHVNGRIYGHHDGTLYPISGTGFYTLNRAEY… |
| A0A6B1P4J4 | 1-125 | MPNARHTVSGSASGEVRKNNSVILRGHERDAAQDIADIASGKAAYNDKTGRYEVNGRTYGVEGTGRVFPDGGPGIVKLDRNEYAALQ… |
| A0A5Q0H4G9 | 49-194 | None |
| A0A2Y9TTW4 | 11-104 | None |
| A0A1W1XUI4 | 241-373 | None |
| A0A066Z295 | 91-234 | None |
| A0A1S7NHX5 | 73-206 | None |
| A0A1B9M4S5 | 1-97 | None |
| A0A640VSW4 | 377-517 | None |
| A0A7W0KF64 | 18-127 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.