DPCstruct | MC18842
Metacluster Properties and Pfam Annotations
| Number of structural domains | 52 |
|---|---|
| Mean domain length (aa) | 193 ± 34 aa |
| Standard deviation of domain lengths | 33.77 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 87.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 30.30 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03752 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B4V0D2 | 8-177 | NAVAIAKILADPASGRAVKREANKALDGTPADRVAFLTTGLAKAQDEDNLVTIVKLLPTGGRAVVREANKALDGTPADRIAFLATGL… |
| A0A6B1NWI5 | 23-258 | ARAEQTSLTQTLASFDRLAASLPKAAAPAAPAPSELDKVSAERDRQLVEDYAEFDEEEEVREAARKALDSSDPNAVKEFLAHGEAEA… |
| K0JQ09 | 300-456 | None |
| W7SWL1 | 35-236 | None |
| W7SYZ0 | 234-422 | None |
| A0A6I5CBP9 | 14-193 | None |
| A0A8A7JCG7 | 12-187 | None |
| A0A640SBS5 | 272-455 | None |
| A0A221R241 | 147-359 | None |
| A0A2A2YVT2 | 2-138 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.