DPCstruct | MC18841
Metacluster Properties and Pfam Annotations
| Number of structural domains | 55 |
|---|---|
| Mean domain length (aa) | 256 ± 46 aa |
| Standard deviation of domain lengths | 45.95 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 88.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 19.98 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0477 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A380EL23 | 25-271 | QRDINYENYLPMYDSKDIENSIYLDQFNGVNSARDNWVTNFSNEKALVNAKLLVDNYNSEIDRLIDILDSRERINLVNKDETFISWT… |
| A0A6B1NWD5 | 258-473 | PFTPAPQSGWDTFPALTELMPWCKPGVKPNRNWVISPSKTILHRRWNRLVQEPDPATKQELFKETRDRTLDKDALQIPGHPHPPTCL… |
| A0A847F800 | 16-292 | None |
| A0A838L135 | 228-518 | None |
| A0A5C8DIN1 | 157-440 | None |
| S3JEV1 | 23-296 | None |
| A0A4U8TPN2 | 887-1267 | None |
| A0A6P0RFX3 | 8-257 | None |
| A0A650EMJ9 | 6-305 | None |
| A0A0M1J4B9 | 72-381 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.