DPCstruct | MC1884
Metacluster Properties and Pfam Annotations
| Number of structural domains | 66 |
|---|---|
| Mean domain length (aa) | 192 ± 36 aa |
| Standard deviation of domain lengths | 36.23 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 68.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.63 |
| Mean length-normalized TM-Score | 0.37 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 25.41 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07818 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P4Q1R3 | 1-126 | METDTQFDESDYANRQVLMRQLLTPKPIEGKDNWGIPPEPEKECDQDLQAKIVHFYQLKERGVHFNKNLLKNKAFRNPHIYNKLVEF… |
| A0A5B0LW43 | 6-197 | NLIGLRYPIGSSYTTALDHTDDRTWNPEEARIGNLIHLRNRKTEPTKTQPTMNTEQAREEPTTHEEKREEQEQTEETKIDPDLQNKI… |
| A0A0F4GAZ5 | 28-224 | None |
| A0A4Y9ZP34 | 28-237 | None |
| E2BEF0 | 67-265 | None |
| A0A4X3PJ78 | 1-121 | None |
| A0A6H5HFW1 | 53-249 | None |
| A0A4Y9Y0A5 | 23-241 | None |
| A0A6A6NYU4 | 34-282 | None |
| K9FP59 | 2-149 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.