DPCstruct | MC18836
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 113 ± 10 aa |
| Standard deviation of domain lengths | 9.64 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 89.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 39.35 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7D7E1C6 | 24-139 | VNVAPYDVSWNPDFVSHEITLNLRSTGSTITKMLQTYLMKDNKLCDSSKMDERGAYCRYVSSYTRMTPAGCGDSRVRATAVEKGIDD… |
| A0A0K9TBZ8 | 1-106 | MHDKTLALQSTGGIIEKTLSTYLMKDGKLCDGSKFGDTDDRGAYCRWVSQMLTFTSSGCDNAKVTVTPNRHPITDKELHDMVLRVDT… |
| A0A6C8YED7 | 4-128 | None |
| A0A080ISR9 | 1-90 | None |
| A0A5N9VVT9 | 16-118 | None |
| A0A370V8I2 | 169-287 | None |
| A0A608E501 | 167-276 | None |
| A0A379XN14 | 58-183 | None |
| A0A6C6ZIY3 | 94-213 | None |
| A0A0U4IZM5 | 135-253 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.