DPCstruct | MC18833
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 183 ± 23 aa |
| Standard deviation of domain lengths | 22.66 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 83.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 40.27 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| J9GMA8 | 2-192 | RRDVRFLTDRMAYELRLSPQQYDDVYEVNYDFLAHVAPLRVEVMYGYRSALDRYYDCLDIRNDDLRWILSSSQYRRFLKAEHFYRPY… |
| A0A2U0U7A2 | 1-177 | MMILAMILVTVTDSTAMPYHQAKREALFLADKMAYELNLTEDQYEAVYEINLDYLMTVSHQSRSYRRPWIRRDNMLRYVLSPWQYRA… |
| A0A1G7JFC3 | 1-184 | None |
| A0A255SDQ4 | 8-154 | None |
| A0A6F9ZBH6 | 16-225 | None |
| A0A3E4W5W6 | 7-236 | None |
| R5KXI6 | 1-194 | None |
| W4P684 | 9-164 | None |
| A0A5P8E9G9 | 9-176 | None |
| A0A239RM23 | 1-158 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.