DPCstruct | MC18829
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 122 ± 14 aa |
| Standard deviation of domain lengths | 14.47 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 74.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.56 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 40.36 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12114 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5F4W0F4 | 375-463 | WRMIQQTPECILMTYQVPERVKEVVLREDLERLESMKQQQPQFSHGQQEELAKVYNWIQSQAIPQEIDVQVTSQSAGITGESHVNLT… |
| A0A6P8SA71 | 1-131 | MEENNHFIKYMLQDPIWLLMANTDDAVMMTYQIPSQNTETVLNNDREKLKLMQKCQPKFTEDQKKELLEIHPWIQKGGLPKAIDVAE… |
| A0A2I0TUJ6 | 430-566 | None |
| W5QBW7 | 127-259 | None |
| A0A5N4DDS1 | 3-117 | None |
| B4DR65 | 139-250 | None |
| A0A2U3X5N7 | 20-131 | None |
| A0A822F1L4 | 493-633 | None |
| A0A7J8G4T8 | 198-328 | None |
| A0A4Z2FRU1 | 2-114 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.