DPCstruct | MC18828
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 258 ± 37 aa |
| Standard deviation of domain lengths | 37.19 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 90.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 20.25 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A372XW40 | 6-270 | LSNLSIHKSVLNILNIKTPINYKTFTEEDDFSMRQLYKALIEHKAIGLTNPQDIFKIRIANINVLLVCQSDNNKKFYLDNAFASPLI… |
| A0A3P5YB28 | 97-346 | KKAFNANIRLKELVDKLKISTDLDSTGWSQKDARTIELLYDGIVNEQVVTLDRVDYNPTQVIQFANVHVLLFLIPENEGTKSYRLYN… |
| A0A838WU90 | 5-278 | None |
| A0A653MNG2 | 323-545 | None |
| A0A1X6X924 | 447-726 | None |
| A0A0Q9HY16 | 229-517 | None |
| A0A7X7N0M8 | 138-399 | None |
| A0A855UL31 | 3-193 | None |
| R6W6Q1 | 1-195 | None |
| A0A0A0DI58 | 327-590 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.