DPCstruct | MC18827
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 136 ± 20 aa |
| Standard deviation of domain lengths | 20.27 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 68.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.90 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 35.00 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13763 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A060QEK5 | 2-104 | FDSNGPDMRVRGTAQQLFEKYLQLGRDATGTGDRILAEAYFQHAEHYFRILNAMTQAAQQSQMERQERHQQRARAQQDHDDRRQGDD… |
| A0A506UR11 | 4-152 | MRSRHSRAGNGAGSSRSGNGQVPLNRNHVFESNGPDLRVRGTAQQLFEKYLQLGRDATGTGDRIQAEAYFQHAEHYFRILNAINQAA… |
| A0A6P1YJ98 | 2-135 | None |
| W6K5W8 | 7-137 | None |
| A0A7C5QW49 | 1-158 | None |
| A0A7H4KEW6 | 1-164 | None |
| A0A437J3C3 | 7-159 | None |
| H6SK94 | 105-236 | None |
| A0A7V9MX78 | 67-202 | None |
| A0A2W7IDA6 | 1-99 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.