DPCstruct | MC18824
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 367 ± 82 aa |
| Standard deviation of domain lengths | 82.30 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 72.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 35.87 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0484 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453G0I5 | 301-629 | TAWPGHLTLTNKALYFEAIGLAGMKKPLRLDLTDHNSKIEKAKVGPFGSRLFDSAVSVSSGSVSNEWTLEFVDFGGEMRRDVWLAFI… |
| A0A1D6L8W8 | 42-403 | WPGRLILTDHALYFEALRVVTYDKPKVYELAEDLKQVVKPELTGPWGSRLFDKAVMYKSTTLTEPVIIEFPELAGHSRRDYWLAIIS… |
| A0A287UC70 | 98-376 | None |
| A0A2Z7D967 | 200-475 | None |
| A0A1D6Q5P6 | 279-528 | None |
| A0A2N9IQT2 | 71-599 | None |
| A0A7J0GEV4 | 1-460 | None |
| A0A4Y7JA98 | 206-698 | None |
| A0A835JRZ9 | 692-1179 | None |
| A0A2K3NMU0 | 207-615 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.