DPCstruct | MC18823
Metacluster Properties and Pfam Annotations
| Number of structural domains | 68 |
|---|---|
| Mean domain length (aa) | 262 ± 59 aa |
| Standard deviation of domain lengths | 58.85 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 87.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 25.21 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1H8H045 | 299-516 | TATDTAPLCGAHFESGVRKYGAVPRNTEYHAEMGLRVLVSALVRTAAKFDVAARPVFSHVTDHYARTYLDVEQGARAANALLDELGH… |
| A0A1D6L8T8 | 3-271 | TATDMAVLCGANGEVCYSKYGSFPTKGKYCHEMALRILLASIESHANRYKRYIVPVLSVFMDFYIRVFVRVFTSASEIKNTPLKLSY… |
| A0A3B4G9B4 | 244-506 | None |
| A0A2A4JVD7 | 204-488 | None |
| A0A017S9L2 | 551-870 | None |
| A0A812NFX7 | 142-386 | None |
| A0A7J0EDA6 | 49-222 | None |
| A0A267G7C3 | 138-393 | None |
| A0A3N4LKK2 | 97-548 | None |
| A0A7C5TKS1 | 5-195 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.