DPCstruct | MC18822
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 81 ± 8 aa |
| Standard deviation of domain lengths | 7.67 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 48.33 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A645BNB2 | 1-70 | MIKLVREVSDIPVAVGFGISAPKQAAEIASVSDGVIVGSAIVKIVGEHGKDAASYVFDYVKSMKEAIGKA |
| A0A1D6L7R2 | 1-81 | MTCGASGIQMVIFLALQVTDKPVAVGFGVSTPEHVKQIVGWGADGVIVGSAIVRQLCEAATPEEGLERLEEYARSMKAAMP |
| A0A4Y7JQF2 | 97-170 | None |
| A0A842N2B3 | 1-87 | None |
| A0A811MLD1 | 185-273 | None |
| A0A838U3L5 | 12-86 | None |
| A0A2G5CK72 | 107-184 | None |
| A0A2G5CJV9 | 125-214 | None |
| A0A4S8K564 | 231-304 | None |
| A0A6V7QRZ3 | 132-224 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.