DPCstruct | MC18821
Metacluster Properties and Pfam Annotations
| Number of structural domains | 102 |
|---|---|
| Mean domain length (aa) | 517 ± 121 aa |
| Standard deviation of domain lengths | 120.71 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 78.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 19.83 |
| Pfam Score | 97.93 |
| Assigned Pfam label(s) | CL0016- PF03169- PF07058 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X7G125 | 413-906 | HWARPLLNWMVLIVLTYIILMTFNILIFRQWAYNEKLIYPLAQLPELLTDSGDDKHWIPEVYRTGFFWCGFLVSGGILGWNLLCKSG… |
| A0A1D6L4S1 | 13-561 | CALLIVLTTQILGYGWAGLLRRYLVDPAEMWWPSNLAQVSLFRALHEKEEEGGKSRGPSRMRFFLIVFFASFAYYALPGYLLPILTF… |
| K9GCJ5 | 24-346 | None |
| A0A446NAY1 | 20-510 | None |
| A0A4S4CWP1 | 250-734 | None |
| A0A4S4DPC3 | 40-494 | None |
| A0A287XHG5 | 17-437 | None |
| A0A6A6LGB8 | 19-474 | None |
| A0A284RBK7 | 57-709 | None |
| A0A0D2NBS0 | 401-1105 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.