DPCstruct | MC1882
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 717 ± 60 aa |
| Standard deviation of domain lengths | 60.22 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 84.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 37.83 |
| Pfam Score | 80.75 |
| Assigned Pfam label(s) | CL0323- PF08354- PF17951 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A109FHW6 | 369-1151 | KRLPVFSMRFLPINVPYHSHLLQGATQAALAAIGDSDSSFWQASKLTCAVYNTEDGTDMREQSSSSILESVFNQIFTSPIYWASKAT… |
| A0A5B0LPC5 | 113-903 | KRRPVFSMRFLPIGVPYHSAHLEGCTARLMGPVEEGGVGEEERAWWEAHKARLSCPVFNTENGVDMRVEHSDLLSSLADLIFTSPIH… |
| A0A317SZM6 | 4-663 | None |
| A0A3N4JTD9 | 21-653 | None |
| A0A2G5BAH8 | 276-1041 | None |
| A0A1Y1W708 | 236-996 | None |
| M2XHU6 | 254-982 | None |
| A0A4S4KM86 | 264-882 | None |
| A0A4S4K6T1 | 124-866 | None |
| A0A0J8S2A9 | 415-1094 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.