DPCstruct | MC18819
Metacluster Properties and Pfam Annotations
| Number of structural domains | 68 |
|---|---|
| Mean domain length (aa) | 87 ± 9 aa |
| Standard deviation of domain lengths | 9.40 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 88.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 37.24 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0113 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C2G3H9 | 124-212 | VNLMKGGIVFARRVTTVSPTYAEEIRTPEFGVGLDGILRQHAAKLRGILNGLDTEVYDPAKDPHLPAPYSREDPSGKARAKEVFREG… |
| A0A1D6L3I2 | 1-86 | MKAGILEADRVLTVSPYYAEELISGIARGCELDNIMRLTGITGIVNGMDVSEWDPSRDKYIAVKYDVSTAVEAKALNKEALQAEVG |
| A0A445BSC4 | 358-451 | None |
| A0A835LFN4 | 85-170 | None |
| A0A1D6FU76 | 165-244 | None |
| O64925 | 286-374 | None |
| A0A388LKG0 | 17-104 | None |
| A0A3S4NJ49 | 126-230 | None |
| A0A445ILS0 | 4-85 | None |
| A0A1U8NU09 | 18-98 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.