DPCstruct | MC18816
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 59 ± 3 aa |
| Standard deviation of domain lengths | 2.68 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 84.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 67.06 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0129 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P6A917 | 76-133 | QYYGQIGIGSPSQSFSVVFDTGSSNLWVPSSKCVVSIPCHFHSKFRARLSSTYTKIGI |
| A0A0K9NXU8 | 108-166 | MDAQYYGEIGIGTSPQIFTVVFDTGSSNLWVPSSECYFSAACYVHLKYKSSQSSTYKKN |
| A0A6J0MP59 | 158-214 | None |
| A0A6S7NQD2 | 1-63 | None |
| A0A453F644 | 19-77 | None |
| A0A446PTU1 | 123-178 | None |
| A0A5N4DUV3 | 76-130 | None |
| A0A446VT04 | 81-142 | None |
| A0A835VL58 | 108-169 | None |
| A0A3L6ET11 | 18-80 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.