DPCstruct | MC18812
Metacluster Properties and Pfam Annotations
| Number of structural domains | 355 |
|---|---|
| Mean domain length (aa) | 170 ± 31 aa |
| Standard deviation of domain lengths | 30.84 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 88.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.47 |
| Mean intra-cluster sequence similarity (%) | 14.63 |
| Pfam Score | 82.25 |
| Assigned Pfam label(s) | PF00557- CL0356- CL0732 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y0RQX3 | 62-237 | MPTEAVGQSSESKRKEIAQLVTKAGADSAVITALDSICWLLNVRGLDVSRLPVLLSHAILHADSSVEYFLDPARLPAEFAAHVGTGV… |
| A0A1D6KDB6 | 22-189 | GITNEEYISRRKKLLEVLPEKSLAIIASADQQMMTDVVPYPFRQNGDYLYITGCTQPGGVAVLSEETGFCMFMPDTNKEDLVWQGET… |
| A0A1F8P9Q6 | 29-233 | None |
| A0A379AHS1 | 24-222 | None |
| R9P3J3 | 522-682 | None |
| C3ZF22 | 567-786 | None |
| C3ZF57 | 98-255 | None |
| A0A1V8S8S6 | 16-185 | None |
| A0A534W7R4 | 7-183 | None |
| A0A7M3RN36 | 7-217 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.