DPCstruct | MC1881
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 327 ± 67 aa |
| Standard deviation of domain lengths | 66.88 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 77.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 19.80 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5B0LLN0 | 12-286 | VVPIWEYLQEKFIKFKCKGEDDADIKLKYLKSLFLLGDYIYKNKLLKGKPTGEIEIFKPDTIINLVNFHVQLLIISQGKRLFESPEW… |
| A0A0L0VJR6 | 86-351 | INIWYSLLKQLDDFKTAQRINPDATKAKFQLDFLKCLFTVGDHIVRYKLIHPELIESSQFLEPKTLLAMVEFHIDLLFLKNGERFFD… |
| E3L128 | 37-289 | None |
| E3L6H5 | 2-254 | None |
| A0A180GX57 | 97-406 | None |
| A0A180GY11 | 252-588 | None |
| A0A2S4WJ43 | 85-505 | None |
| A0A2S4WJ89 | 98-492 | None |
| A0A2S4UGE1 | 296-624 | None |
| A0A5B0PYF3 | 5-429 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.