DPCstruct | MC18809
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 66 ± 3 aa |
| Standard deviation of domain lengths | 3.19 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 87.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 53.15 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J7DB07 | 399-462 | CEAMSTYPRTYDLIHADSVFSLYEDRCEMEDILLEMDRILRPEGSVIFRDDVDVLVRMKRIADG |
| A0A1D6K808 | 1-68 | MSTYPRTYDLIHADSMFTLYKNRCEMDRILLEMDRILRPRGTVIIREDVDLLVKVKSLANGISRRTVK |
| A0A803L759 | 576-640 | None |
| A0A6V7NID6 | 108-178 | None |
| A0A6M2F1B3 | 188-253 | None |
| A0A804LMY8 | 113-176 | None |
| A0A6P5ZL39 | 9-73 | None |
| A0A834LHH9 | 7-81 | None |
| A0A7C8YV04 | 7-78 | None |
| A0A4D6LPJ7 | 582-647 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.