DPCstruct | MC18807
Metacluster Properties and Pfam Annotations
| Number of structural domains | 67 |
|---|---|
| Mean domain length (aa) | 430 ± 75 aa |
| Standard deviation of domain lengths | 75.01 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 82.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 21.96 |
| Pfam Score | 94.64 |
| Assigned Pfam label(s) | CL0020- PF20422 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7F8Q1G6 | 5-353 | QQHPQTHRQLKETLYEIIIGYFDKGKMWEEAISLCKELAEQYEMEIFDYELLSQNLIQQAKFYENIMKILRPKPDYFAVGYYGQGFP… |
| A0A1D6K1I5 | 769-1266 | APEGSSDNRWSWVEVKHLSKCLVQALDAGLEHALLGSVVTVDRYAAAEGFYKLAMAYAPVPDLHIMWLLHLCDAHQEMQSWAEAAQC… |
| F4PY03 | 7-321 | None |
| A0A836DAY9 | 546-1052 | None |
| A0A7S3GDD7 | 35-532 | None |
| K3X541 | 158-667 | None |
| A0A6V7PEK0 | 28-422 | None |
| A0A819XEM5 | 2-279 | None |
| G3HTI1 | 27-407 | None |
| A0A5F4VWL2 | 48-331 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.