DPCstruct | MC18805
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 44 ± 5 aa |
| Standard deviation of domain lengths | 5.16 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 81.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.82 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 51.00 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10708 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y1ZY56 | 1-39 | MPAGWYADPSGRYELRYWDATAWTEHVSRAGQQFTDPPV |
| A0A533RZ34 | 31-75 | APATASPPSPASWQADPSGRHQLRYWDGTQWTDTVSDEGLASVDP |
| A0A533RQI9 | 52-91 | None |
| A0A7K0ZWK4 | 54-107 | None |
| A0A2E8Y176 | 12-59 | None |
| A0A3C2B2M3 | 124-182 | None |
| A0A6L6CB87 | 1-39 | None |
| A0A1P8U9M0 | 44-94 | None |
| A0A443JRL3 | 3-42 | None |
| A0A6J6XR74 | 2-46 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.