DPCstruct | MC18802
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 128 ± 14 aa |
| Standard deviation of domain lengths | 14.24 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 28.22 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13785 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M1TR13 | 1-122 | MAGAKKIACTQCGAPLEIQNPRAKTVVCAHCGAQLDLTSPDYAFLGVVQREPLLTPLKVGQSGTDTEGVTWTIIGMMRLREDSWYWD… |
| A0A3D2U8H9 | 75-199 | ADNPVVVEAAAQVGAESVNCPSCAGPLTIQDPGASQRIACQYCGALHAVNDGKLKFLEELGKPEHKPIIPLGSEGELQGIKFTVIGY… |
| A0A3M9MCK7 | 27-148 | None |
| A0A2H0P8F4 | 1-129 | None |
| A0A0K0SY97 | 165-291 | None |
| A0A377R3E5 | 218-363 | None |
| A0A6A0IP15 | 227-339 | None |
| A0A257S504 | 3-131 | None |
| M3GR89 | 242-335 | None |
| M6TVN6 | 66-201 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.