DPCstruct | MC1880
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 238 ± 22 aa |
| Standard deviation of domain lengths | 21.72 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 77.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 22.35 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0L6UKF2 | 15-248 | EALHYFQNEYRTNPVRRTALLKEVFQYLALKDFSSPKHFEEWCRELEAACSPPNNPIQYSGLIIYGLQTLILQNLERGDLTALISPA… |
| A0A5B0LJ69 | 1-224 | MKTEFIPEYKVHLIQRMFKNILENPGVTDDEIKHWFEVLAYVIRKTREVRAGSTESHLAVSALYGLHSLRMRLPERQALLTHIDALS… |
| A0A2N5S5M3 | 2-235 | None |
| A0A0L6V6L1 | 48-298 | None |
| A0A180GAH7 | 78-301 | None |
| A0A2N5VU92 | 86-341 | None |
| A0A2N5V2R7 | 23-243 | None |
| A0A180GYC2 | 165-402 | None |
| A0A180GVM7 | 62-329 | None |
| A0A2N5SRG0 | 15-201 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.