DPCstruct | MC188
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 80 ± 7 aa |
| Standard deviation of domain lengths | 6.67 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 89.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 22.51 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3N5UWG9 | 1-78 | MKVLVKSAWGSDDPTKAAFPFLHGNALAEAGHEVQIFLLGEAVSLLRTPVANAVIPVGWPPLAETLQKTISLGIPIHV |
| A0A662K2G8 | 2-78 | KKFLFVISNGFEKAGRATRAFQFAQVACEKGHDVKVFLVDDAIHWAQFGMADGAKASTGEEMKPFIDYLTEHGATIY |
| A0A0T5ZZ34 | 1-89 | None |
| A0A831ZCZ4 | 101-184 | None |
| R1C660 | 3-91 | None |
| A0A2E7Z6B9 | 1-76 | None |
| A0A3A5AQ67 | 26-115 | None |
| A0A2V9K2D8 | 6-75 | None |
| A0A0A1CYB3 | 3-74 | None |
| A0A6J6ZGC7 | 5-78 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.