DPCstruct | MC18793
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 192 ± 14 aa |
| Standard deviation of domain lengths | 14.00 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 80.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 35.87 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A218PFC5 | 4-185 | GFLDVFTSLSDMVAGAFGINAETKKEDIGKYFTDIANTMNTVKAKLNDVVAKNGNYPKVKSVVDTFITNTLDKIADGAKTAAKGATG… |
| I0FF13 | 43-214 | MGCNSGVKDPEKVFLSEMVNLGKGFLDVFLSFGDMVVGAFGIKAETKKSDVGKYFSDIAATMEFVKNKLQMEIAKNMHYAKVKKVVD… |
| A0A482CYJ2 | 2-185 | None |
| A0A142JDL6 | 2-191 | None |
| W5SPN7 | 45-254 | None |
| W5SXA0 | 20-211 | None |
| W5SX24 | 34-243 | None |
| W5SX15 | 5-196 | None |
| W6TVP2 | 9-217 | None |
| I0FFD1 | 9-178 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.