DPCstruct | MC18792
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 338 ± 44 aa |
| Standard deviation of domain lengths | 44.48 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 81.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 18.69 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W0FXF1 | 6-281 | TDPKLKALLDNFGVSEAGRKAIGYIQEILRVSYKNGFDDKFYNCLNKLGADFVIEKIIKPTVSLLRARGKALEVIEGTTDEGVKTRL… |
| I0FEB0 | 17-343 | CKTQTSPQTTSTDTKKHLMSTLTEFDETPTEIRTTISQTQQPDDIIDIDTIKSQDIEEALNFIKEALNQATSQDRKIDAEAKINELT… |
| W5SKZ9 | 6-406 | None |
| W5SPZ8 | 44-425 | None |
| T1ECR8 | 7-347 | None |
| W5SKH7 | 29-389 | None |
| W5T220 | 449-740 | None |
| W5T2B1 | 16-309 | None |
| W5SBK1 | 120-455 | None |
| W5SK75 | 9-358 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.