DPCstruct | MC1879
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 527 ± 52 aa |
| Standard deviation of domain lengths | 52.24 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 80.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 26.59 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00425- PF04715- CL0014 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A367KPS9 | 10-461 | HIVKDFGLCTQLLEVQLDPNQSEYHRPIFGICLGHQGIGHVFGGKVTYAPRIMHGRMSQIHVLPSEHDVLTDCPSPFWAVRYHSLVV… |
| M5FSQ7 | 254-777 | QPSLFRELPFPMGVGVIIDCYDSYTNNLLPCLNTANLPPQEFERYLESSVAVIRLHTFPWPVFRDHVLPHLEWVIISPGPGRPDNTR… |
| A0A2I0JLC1 | 69-632 | None |
| A0A5N6L0B8 | 357-801 | None |
| D8QZ33 | 108-650 | None |
| N1S1Q0 | 405-980 | None |
| A0A1J7IPC0 | 5-532 | None |
| A0A287XHX8 | 3-615 | None |
| M8CF30 | 11-509 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.