DPCstruct | MC18789
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 115 ± 14 aa |
| Standard deviation of domain lengths | 13.77 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 81.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 42.37 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0Q6Z1V0 | 20-118 | NHQNACDLLAEVERLNKIMNTPVIEPFVEAAVSEAKHQVYRWGAEHDASKTAWDWYWLAGYLTSKAAHATLEENWEKAKHHTVTAAA… |
| A0A2A4TCY8 | 3-111 | SPTDIDSLSHADLLAAHKRLLGIVNRPLIKDFIAAVVNEAAHQRDRWGAEHGASKNPEDWFWNVGYLSGKALAAFKAGDRDKALHHT… |
| A0A2A5DME6 | 101-213 | None |
| A0A3R8V1E5 | 345-450 | None |
| A0A522ZYH2 | 1-116 | None |
| A0A2A6NQV1 | 428-564 | None |
| A0A7Y8UJ11 | 23-127 | None |
| A0A833V7K8 | 58-194 | None |
| A0A1G6KFN6 | 25-142 | None |
| A0A369Q884 | 149-273 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.