DPCstruct | MC18788
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 137 ± 18 aa |
| Standard deviation of domain lengths | 17.54 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 83.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 27.82 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07098 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2A4T4E0 | 5-144 | TTWNIIFMFLFLLLLSLGYWGLTDGLDNFGWLHLISTTDIVLISLATFRLIRLVTYDKIFAFARNLFLDRTEDGSYIKTEGGFRRTV… |
| O31623 | 3-117 | INGLTIVLLSLAVFRLARLLVFDTIMAPLRSLFHEEKEEKDADGNIETYIVIKGTGVRAFIGELLSCYWCTGVWCAGFLILCQAVIP… |
| G8TZV7 | 4-117 | None |
| A0A3N5KVV2 | 8-128 | None |
| A0A1F6SNC9 | 5-122 | None |
| A0A2W6ASQ6 | 20-168 | None |
| A0A6G8QEJ0 | 139-283 | None |
| A0A7V9KZG2 | 2-111 | None |
| A0A3M1DBV0 | 38-176 | None |
| A0A1T3NK55 | 60-215 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.