DPCstruct | MC18787
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 93 ± 13 aa |
| Standard deviation of domain lengths | 13.36 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 87.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 46.70 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0014 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2A4T1N4 | 16-91 | REPFNAAEFKHLKEYVSKGGSLLVCLGEGGESKNNTNINFLLEQFNISVNNDSVVRTMYYKYHHPKECYVSHGMVN |
| G0R1W0 | 46-137 | ERLKMAHLVVFFCPKDLFNKQEFEALKQYIQNGGRLFFLSSEGGEHKNQTNINYFLEQYGISVNSDCVVRTAFYKYFFPKETFISNG… |
| A0A7R9Q2B8 | 57-140 | None |
| D7FI94 | 46-162 | None |
| A0A812YLW8 | 47-131 | None |
| A0A6J3J8G5 | 94-210 | None |
| A0A1W0A6I4 | 56-157 | None |
| A0A5J4U5J2 | 29-98 | None |
| A0A7J5Z3N9 | 48-132 | None |
| A0A5K3EIJ7 | 55-148 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.