DPCstruct | MC18786
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 55 ± 5 aa |
| Standard deviation of domain lengths | 4.85 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 88.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.96 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 68.23 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5K3G358 | 36-95 | LGCTERLVVTPLTDRCYITLSQALNMHLGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNC |
| A0A2A4T0R4 | 1-53 | MGATSRLVITPLTDRCWVTITGALHIKLGAAPAGPAGTGKTESTKDLAKALGM |
| A0A2V2VJU2 | 103-164 | None |
| A0A821TRQ1 | 1-53 | None |
| A0A3Q0JGM1 | 389-436 | None |
| A0A0V0QKW0 | 100-158 | None |
| A0A7S2WIS6 | 61-120 | None |
| U6KZ18 | 129-188 | None |
| A0A182T3K7 | 904-951 | None |
| A0A444T526 | 61-113 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.