DPCstruct | MC18785
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 59 ± 5 aa |
| Standard deviation of domain lengths | 5.28 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 46.31 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V5XJQ7 | 1-53 | MNCVLYDRECTDCGECDICDLDRNKRCDSCGRCLDSEFDYKAVKIDEIMLGDD |
| A0A7X9GPR3 | 1-58 | MRKYGESCVLEERLCTECGECDTCELNSSKICDSCCECLETSSDYLEIQIDDILINTE |
| A0A0A2TKI9 | 1-59 | None |
| A0A6A7K7A9 | 1-69 | None |
| A0A0L6JJ36 | 1-54 | None |
| A0A847N9T3 | 3-69 | None |
| A0A4R5JHS2 | 1-62 | None |
| A0A1C6EQ74 | 10-71 | None |
| A0A2K2F1Y0 | 1-57 | None |
| A0A017RUC3 | 3-59 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.