DPCstruct | MC18784
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 223 ± 56 aa |
| Standard deviation of domain lengths | 56.30 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 77.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 23.05 |
| Pfam Score | 92.86 |
| Assigned Pfam label(s) | PF09661- PF09660 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C4MQ05 | 1-136 | ESINSSVYDEEPDCVEIRPKVRSYKEKSSRRAIEYKTERKQEMLAQYLRILEEEKLIIEGYIKDNAIRISDLPIIKPHVRVTLLKWI… |
| A0A7X9GNU8 | 8-160 | AHTRHLYVEDSKETESLNREIWEEPAGMVNIRPKVRNFREKTRPNAVLDQTARKKATMEAYLAEKAREQELMDELVKGNRIVLRDLK… |
| A0A413CQ43 | 78-299 | None |
| A0A221W8M4 | 306-595 | None |
| Q47LG8 | 4-198 | None |
| A0A6B2YQZ1 | 3-144 | None |
| A0A7X5IZ67 | 92-373 | None |
| A0A0B8MZY9 | 44-232 | None |
| A0A1Q6N714 | 250-472 | None |
| A0A384HJ66 | 43-238 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.