DPCstruct | MC18783
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 161 ± 14 aa |
| Standard deviation of domain lengths | 13.58 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 64.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.59 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 31.37 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1L9VYL6 | 65-214 | DRTTPEETSGESSGSDGDLPSPSPAAPVHSTQGHGRNRRRAQPGRGNSQEATFNSKSSKSVKNTRQYCTIECVRGLLIRSCLDRKCP… |
| A0A0G4P418 | 541-702 | VKTRSKSTVAGFASCAPLEALSSSESDDSPDGSDPNTPSRQPQGSRFTDSSALPPSSAATIPRDGSYSKGKSRQYCTQRCLLGLVTR… |
| A0A5N6FIG5 | 161-330 | None |
| A0A179EWR8 | 424-592 | None |
| A0A0A2L4K7 | 405-574 | None |
| A0A7C8L1W7 | 44-200 | None |
| A0A2C5YD27 | 681-836 | None |
| C9SVS3 | 193-363 | None |
| Q2GZ78 | 306-470 | None |
| A0A017RZM3 | 66-241 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.