DPCstruct | MC18781
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 251 ± 20 aa |
| Standard deviation of domain lengths | 20.13 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 74.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 26.21 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A545W2U3 | 23-252 | DPQANLRPINITGLPYYFYRWTGSYYNGSTTIHIEPKEFEEDTDKDTRITQPIEVTYENSILAIVKSNGYVKDQNELTFSLRYWDKN… |
| A0A2I2G7F1 | 1-287 | MSSTIGYYNGTAEFKLTPLTDRDYDEPPCEPLRNISVTSSWNSILSIIEPGSKNIGSNPVNLVLNSFLPNYDWSKSPRLGLLWGNEG… |
| A0A1B8FD55 | 2-220 | None |
| A0A146FA43 | 1-240 | None |
| A0A168E4C4 | 2-253 | None |
| B8M6C8 | 3-263 | None |
| A0A0M9EU09 | 10-276 | None |
| A0A6A6VME6 | 9-257 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.