DPCstruct | MC18780
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 62 ± 6 aa |
| Standard deviation of domain lengths | 6.00 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 88.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 48.34 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0080 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A423XH90 | 85-145 | NGADGLNFYSSTLRKPVRELPCKAYCATCHTPILDEGRNMVMLFPELIKDIHSEKGKEAFK |
| V5HRS7 | 165-233 | FKDGSQGLSFYASGEKSRDYQTPTKVSCSFCRTPIMDEGRNVVLLFPELIDFGHTDEEQRERRKVFEVK |
| A0A817QKZ8 | 50-99 | None |
| A0A072PFY3 | 53-118 | None |
| A0A7G5IZ52 | 97-153 | None |
| G2R612 | 97-159 | None |
| A0A1V6QAQ2 | 741-802 | None |
| A0A2N3N1E0 | 495-551 | None |
| A0A3A2ZWG3 | 1-70 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.