DPCstruct | MC1878
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 314 ± 38 aa |
| Standard deviation of domain lengths | 37.64 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 67.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 20.99 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5B0NIS2 | 5-301 | GRCPDPKSSRLCALEEPLESKQQSSTAMKKFHMRLVSKLNLNTLGQKRRLNKAILKNPQAGHSASSRRSYLQKQWGIHQEQMELFAK… |
| A0A5B0LIG0 | 1-268 | MKTEKSLSPGYRSHDNGVWNYDRLSQLTRVFRELMDRLTGDTSWSREIRSRIIGNWVVNSDKVMALYKNLMELSHYQVPLVGTFQDV… |
| A0A2S4UW08 | 408-760 | None |
| A0A5B0Q0J6 | 1-262 | None |
| A0A2S4W2X4 | 47-319 | None |
| H6QPW3 | 1-358 | None |
| A0A5B0R1A7 | 29-364 | None |
| A0A5B0S180 | 9-331 | None |
| A0A0L0W053 | 45-402 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.