DPCstruct | MC18777
Metacluster Properties and Pfam Annotations
| Number of structural domains | 5 |
|---|---|
| Mean domain length (aa) | 285 ± 17 aa |
| Standard deviation of domain lengths | 16.52 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 74.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 26.61 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C9SP84 | 267-537 | QTCSEPADVAKALRGVFDITTEKHNRITVVGGFSCAFIAAISHWLFDLTTYVEDENGKVLFAPSIGECPIDPITAKVHVQYGSETTT… |
| A0A2B7YPI6 | 197-462 | GSPFILGGALSLLADVSCGKVASITFRGGVECAWLAAVAEWLLSLRVEVINAQDGSLLYRKFSCSGLERVQITILRGDGEDNCQCLF… |
| W7LFZ3 | 188-480 | None |
| A0A3N4HES2 | 203-514 | None |
| A0A0G4M8E9 | 78-358 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.