DPCstruct | MC18773
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 84 ± 6 aa |
| Standard deviation of domain lengths | 5.85 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 83.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 24.83 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E0UJA0 | 59-135 | IRTFYIYKNGVLTLALEDRPGTLHSMASPPPTGAPTHPFIHGSAYDAKSEDEMGTLLRKSTSFDNYINLLIEAGYDV |
| A0A7Y6PNY9 | 38-117 | PRSWRVYDGDVEILEVSDQPGPLVSTAPLPPDATPAMHPFLSATALEASHEDRLRGILERSHDVDEFVRLLQAEGFRVVA |
| A0A1K2FDN5 | 7-92 | None |
| A0A2E5HPD1 | 5-83 | None |
| A0A5J4WD15 | 23-101 | None |
| A0A6N2CVT6 | 70-156 | None |
| A0A7Y5KUY2 | 125-221 | None |
| L1J9P1 | 180-260 | None |
| A0A3A8QLU1 | 1-86 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.