DPCstruct | MC1877
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 124 ± 20 aa |
| Standard deviation of domain lengths | 20.27 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 80.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 33.25 |
| Pfam Score | 33.33 |
| Assigned Pfam label(s) | PF05699- PF14372 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5B0NH18 | 1-103 | MEGDGPTGSVAIPEYLQMKINLKKKLDSSLRSDPLHPMFVKMLEKTNTYLQEALACETLVISTILNPSFRLAIFEKHFPQEASEAKK… |
| A0A5B0LI04 | 1-123 | MEGNISSASMMLAEYWNIKEYLQKKLASFTEPEFTSMINKMIAKTNIYIKEALDCDVILLATTLNPAYRLSMIQQWFPSHHTKAQVL… |
| A0A0L0W1B7 | 387-497 | None |
| A0A5B0QRI7 | 1-117 | None |
| A0A2S4V5M0 | 207-332 | None |
| A0A5B0QRF1 | 633-741 | None |
| A0A2N5V2D1 | 31-182 | None |
| A0A2N5VMX2 | 1-146 | None |
| A0A0L0VPA6 | 398-503 | None |
| A0A2S4VRJ6 | 1-120 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.