DPCstruct | MC18765
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 183 ± 16 aa |
| Standard deviation of domain lengths | 16.40 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 89.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 35.29 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0199- CL0733 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6S7CLX0 | 107-287 | VDNFFLQVQGSGRVQLTEGPDSGKTIRVAYADHNGQPYASIGRWLIDRGELTADQASMQNIRAWAQRNPKRVPEMLNANPAVVFFRE… |
| A0A7C5DR99 | 49-249 | TGILDGHSEILAWVGDPIDLFFLQIQGSGKIILESGNYINVHYHTINGHPYRSIGRMLIDEGKIAREEMSMQKIRSYLKEHPEEVER… |
| A0A2T4JJ96 | 129-298 | None |
| A0A1Q7BQE9 | 189-385 | None |
| A0A379GB30 | 14-180 | None |
| A0A3L7N6R4 | 3-166 | None |
| A0A109LJ55 | 8-178 | None |
| A0A5B8XKM8 | 345-523 | None |
| A0A447T2P8 | 137-283 | None |
| A0A2X1PLG7 | 9-180 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.