DPCstruct | MC18764
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 136 ± 19 aa |
| Standard deviation of domain lengths | 18.72 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 71.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 19.27 |
| Pfam Score | 92.86 |
| Assigned Pfam label(s) | PF04246- PF17188 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5K7YJ81 | 1-101 | MKVEAINTADARVGDRIVLNIQTSSLLKATFLLYVFPILAMIAGAVLGQTVAGMRSMDPSGLSALFGFLFFGLAFIVIRITGRRLSK… |
| A0A7C4X771 | 2-141 | LKELGMVEDVMNKEVVVRLSKGEHCQTCPSKGMCHLGHDEERLVKVKTDIKLVKGQVVEIGIPEGELLKLSFLVYFLPILSLMVFST… |
| A0A2Z2NZX8 | 1-143 | None |
| A0A4R5H949 | 2-150 | None |
| A0A2G2LBG4 | 16-171 | None |
| A0A355IU26 | 1-134 | None |
| A0A2N6FMC2 | 4-144 | None |
| A0A2E2HEW2 | 84-232 | None |
| A0A368NPM5 | 3-159 | None |
| A0A257LSD9 | 66-189 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.