DPCstruct | MC18763
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 193 ± 32 aa |
| Standard deviation of domain lengths | 31.65 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 72.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 50.56 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T2T5H0 | 35-193 | FGIISAFRPFKGVFTKDFTDEEQKVLIKVAKSVSLTRDFLRENDGIYIKLCNCKMFNKAFVDKFTTDKSKATMKDFMSTQGFITRYK… |
| J0PAZ2 | 6-211 | IKGSTIESSNLNSIVNKIKSGLPFGTISAFRPFKEAFIKDFTQDERELLVEAYKSGYSKADADKITQYWQDKSAKIDLHKPIKAKDF… |
| M3P0F3 | 44-247 | None |
| A0A1A9H452 | 42-200 | None |
| A0A6C0Z5G7 | 13-171 | None |
| M7RX44 | 70-307 | None |
| M3NZZ1 | 1-179 | None |
| A0A2A6Z184 | 2-160 | None |
| J0A0B7 | 63-292 | None |
| I9TX50 | 71-298 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.