DPCstruct | MC1876
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 214 ± 23 aa |
| Standard deviation of domain lengths | 22.85 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 81.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 19.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3S0DS55 | 15-208 | VVADPAGREVLSWLVVASLLEAHAELGVVETHPGYDGEYDCLSVYDRTRLDRGPLLDLDRNGVAHIAPLAGGADTWPDVWDRCAEDG… |
| A0A1I2G2G2 | 119-353 | PHWRLVNVESWWIASELVRRHPELVVYEMHPGGGQYDVLSVRRADTVGEGSMREAHVMLNRQGTIQVHAGAEFDTTPVATWMVVLGE… |
| A0A521EY41 | 1-216 | None |
| A0A7Z7CYJ7 | 1-231 | None |
| A0A3N4YQ66 | 6-236 | None |
| A0A840R1B7 | 10-232 | None |
| A0A6J6DS98 | 7-204 | None |
| A0A2P7AFR0 | 1-231 | None |
| A0A4P7UEY0 | 3-174 | None |
| A0A847QU14 | 1-197 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.