DPCstruct | MC18757
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 187 ± 22 aa |
| Standard deviation of domain lengths | 21.81 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 70.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 24.88 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E0SQ25 | 1-204 | MKKLLAYMLVTALLAVSAEVSVAKSKQKTPVPPEVGYFYVPGTQEVVSHEVEARLQKEQPELLTVSFQAPDAPPAEPLPYPQEPTSV… |
| A0A3B9CWY8 | 66-242 | QNRFQQVAPTPTVIQSGLSRRPVTVTRPRSSFTITFGNQGVVRPAVQPVIQPVIQPVPQPPILPPAPAPVRGSFAHLAHQYGHFVTC… |
| A0A142WXB3 | 1-186 | None |
| A0A7W0M763 | 30-232 | None |
| A0A3D4PCI0 | 1-174 | None |
| A0A2D6STN9 | 20-156 | None |
| A0A2S8FAX2 | 3-193 | None |
| A0A517P637 | 282-481 | None |
| A0A2E7DB64 | 149-363 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.